FAM130A2 (CSRNP3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CSRNP3 Antibody is: synthetic peptide directed towards the N-terminal region of Human CSRNP3. Synthetic peptide located within the following region: KMTKNGTVESEEASTLTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRAL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	cysteine and serine rich nuclear protein 3
Database Link	NP_079245 Entrez Gene 80034 Human UniProt ID Q8WYN3
Background	CSRNP3 binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity. It plays a role in apoptosis.
Synonyms	FAM130A2; PPP1R73; TAIP-2; TAIP2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.