CLPB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CLPB Antibody: synthetic peptide directed towards the N terminal of human CLPB. Synthetic peptide located within the following region: QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	78 kDa
Gene Name	ClpB homolog, mitochondrial AAA ATPase chaperonin
Database Link	NP_110440 Entrez Gene 81570 Human UniProt ID Q9H078
Background	CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.
Synonyms	ANKCLB; HSP78; MEGCANN; MGCA7; SKD3
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rat: 92%; Mouse: 92%; Bovine: 86%; Rabbit: 85%; Pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.