REXO5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LOC81691 Antibody: synthetic peptide directed towards the middle region of human LOC81691. Synthetic peptide located within the following region: AEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKLKDVQRQLKAL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	85 kDa
Gene Name	RNA exonuclease 5
Database Link	NP_112203 Entrez Gene 81691 Human UniProt ID Q96IC2
Background	The exact functions of LOC81691 remain unknown.
Synonyms	DKFZp434J0315
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 85%; Pig: 75%; Guinea pig: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.