Apg10 (ATG10) Rabbit Polyclonal Antibody
CAT#: TA335432
Rabbit Polyclonal Anti-ATG10 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ATG10 Antibody: synthetic peptide directed towards the C terminal of human ATG10. Synthetic peptide located within the following region: TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | autophagy related 10 |
Database Link | |
Background | Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12-ATG5 conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A), a homolog of yeast Apg8, to a membrane-bound form.Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12 (MIM 609608)-ATG5 (MIM 604261) conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A; MIM 601242), a homolog of yeast Apg8, to a membrane-bound form (Nemoto et al., 2003 [PubMed 12890687]). [supplied by OMIM] |
Synonyms | APG10; APG10L; pp12616 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%; Horse: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |