Apg10 (ATG10) Rabbit Polyclonal Antibody

CAT#: TA335432

Rabbit Polyclonal Anti-ATG10 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (2)
Transient overexpression lysate of ATG10 autophagy related 10 homolog (S. cerevisiae) (ATG10), transcript variant 2
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-ATG10 Antibody: synthetic peptide directed towards the C terminal of human ATG10. Synthetic peptide located within the following region: TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 25 kDa
Gene Name autophagy related 10
Background Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12-ATG5 conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A), a homolog of yeast Apg8, to a membrane-bound form.Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12 (MIM 609608)-ATG5 (MIM 604261) conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A; MIM 601242), a homolog of yeast Apg8, to a membrane-bound form (Nemoto et al., 2003 [PubMed 12890687]). [supplied by OMIM]
Synonyms APG10; APG10L; pp12616
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%; Horse: 79%; Guinea pig: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...