FAM105B (OTULIN) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM105B Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM105B. Synthetic peptide located within the following region: NRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	OTU deubiquitinase with linear linkage specificity
Database Link	NP_612357 Entrez Gene 90268 Human UniProt ID Q96BN8
Background	FAM105B is a deubiquitinase that specifically removes linear ('M-1'-linked) polyubiquitin chains to substrates and acts as a regulator of angiogenesis. It associates with the LUBAC complex via direct interaction with RNF31 and counteracts its action by cleaving linear polyubiquitin chains to substrates. It is required during angiogenesis, craniofacial and neuronal development by regulating the canonical Wnt signaling together with the LUBAC complex. FAM105B acts as a negative regulator of NF-kappa-B by counteracting activity of the LUBAC complex
Synonyms	AIPDS; FAM105B; GUM
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.