FAM114A1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM114A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM114A1. Synthetic peptide located within the following region: WVEEDQTVVSVDVAKVSEEETKKEEKEEKSQDPQEDKKEEKKTKTIEEVY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	61 kDa
Gene Name	family with sequence similarity 114 member A1
Database Link	NP_612398 Entrez Gene 92689 Human UniProt ID Q8IWE2
Background	FAM114A1 may play a role in neuronal cell development.
Synonyms	Noxp20
Note	Immunogen Sequence Homology: Goat: 100%; Human: 100%; Yeast: 91%; Rat: 86%; Pig: 82%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.