HLTF Rabbit Polyclonal Antibody

CAT#: TA335401

Rabbit Polyclonal Anti-SMARCA3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4537.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Transient overexpression lysate of helicase-like transcription factor (HLTF), transcript variant 1
    • 100 ug

CNY 3080.00


Transient overexpression lysate of helicase-like transcription factor (HLTF), transcript variant 2
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-SMARCA3 Antibody: synthetic peptide directed towards the N terminal of human SMARCA3. Synthetic peptide located within the following region: DPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 114 kDa
Gene Name helicase-like transcription factor
Background SMARCA3 (HLTF) is a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA3 contains a RING finger DNA binding motif. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform which is truncated at the N-terminus as compared to the full-length protein.
Synonyms HIP116; HIP116A; HLTF1; RNF80; SMARCA3; SNF2L3; ZBU1
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...