TRIM35 Rabbit Polyclonal Antibody
CAT#: TA335369
Rabbit Polyclonal Anti-Trim35 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Trim35 Antibody is: synthetic peptide directed towards the middle region of MOUSE Trim35. Synthetic peptide located within the following region: AAGWLKVADDLTSVINHGYRVQVENPERFSSAPCLLGSQVFSKGSHSWEV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | tripartite motif containing 35 |
Database Link | |
Background | Trim35 may play a role as a tumor suppressor. It implicated in the cell death mechanism. |
Synonyms | HLS5; MAIR |
Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |