ATP11C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Atp11c Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GLKVWVLTGDKMETAKSTCYACRLFQTNTELLELTTKTIEESERKEDRLH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	129 kDa
Gene Name	ATPase phospholipid transporting 11C
Database Link	NP_775965 Entrez Gene 286410 Human UniProt ID Q8NB49
Background	The function of Atp11c remains unknown.
Synonyms	ATPIG; ATPIQ
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.