Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	7 kDa
Gene Name	ubiquinol-cytochrome c reductase, complex III subunit X
Database Link	NP_037519 Entrez Gene 29796 Human UniProt ID Q9UDW1
Background	UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane.UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]). [supplied by OMIM]
Synonyms	HSPC051; HSPC119; HSPC151; QCR9; UCCR7.2; UCRC
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 93%; Bovine: 93%; Dog: 86%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.