C1ORF95 (STUM) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C1orf95 antibody: synthetic peptide directed towards the middle region of human C1orf95. Synthetic peptide located within the following region: VFWLNIAAALIQILTAIVMVGWIMSIFWGMDMVILAISQGYKEQGIPQQL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	15 kDa
Gene Name	stum, mechanosensory transduction mediator homolog
Database Link	NP_001003665 Entrez Gene 375057 Human UniProt ID Q69YW2
Background	The exact function of C1orf95 remains unknown.
Synonyms	C1orf95
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rabbit: 93%; Dog: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.