FMO3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	flavin containing monooxygenase 3
Database Link	NP_001002294 Entrez Gene 2328 Human UniProt ID P31513
Background	FMO3 is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. It N-oxygenates primary aliphatic alkylamines as well as secondary and tertiary amines. It acts on TMA to produce TMA-N-oxide.
Synonyms	dJ127D3.1; FMOII; TMAU
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Rabbit: 93%; Guinea pig: 90%; Horse: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane
Protein Pathways	Drug metabolism - cytochrome P450

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.