TRPM2 Rabbit Polyclonal Antibody
CAT#: TA335274
Rabbit Polyclonal Anti-TRPM2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
Cited in 1 publication. |
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 171 kDa |
Gene Name | transient receptor potential cation channel subfamily M member 2 |
Database Link | |
Background | TRPM2 is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death.The protein encoded by this gene is a calcium-permeable cation channel that is regulated by free intracellular ADP-ribose. The encoded protein is activated by oxidative stress and confers susceptibility to cell death. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | EREG1; KNP3; LTRPC2; NUDT9H; NUDT9L1; TRPC7 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Pig: 88%; Guinea pig: 88%; Dog: 86% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
LINC00885 a Novel Oncogenic Long Non-Coding RNA Associated with Early Stage Breast Cancer Progression
,Abba, MC;Canzoneri, R;Gurruchaga, A;Lee, J;Tatineni, P;Kil, H;Lacunza, E;Aldaz, CM;,
Int J Mol Sci
,PubMed ID 33049922
[TRPM2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |