PDX1 Rabbit Polyclonal Antibody
CNY 5200.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse, Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PDX1 antibody: synthetic peptide directed towards the N terminal of human PDX1. Synthetic peptide located within the following region: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 31 kDa |
Gene Name | pancreatic and duodenal homeobox 1 |
Database Link | |
Background | The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Jul 2008] |
Synonyms | GSF; IDX-1; IPF1; IUF1; MODY4; PAGEN1; PDX-1; STF-1 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 92% |
Reference Data | |
Protein Families | Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Protein Pathways | Maturity onset diabetes of the young, Type II diabetes mellitus |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |