LRRC37A3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LRRC37A3 antibody: synthetic peptide directed towards the middle region of human LRRC37A3. Synthetic peptide located within the following region: NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	180 kDa
Gene Name	leucine-rich repeat containing 37 member A3
Database Link	NP_955372 Entrez Gene 374819 Human UniProt ID O60309
Background	The specific function of this protein remains unknown.
Synonyms	LRRC37; LRRC37A
Note	Immunogen Sequence Homology: Human: 100%; Dog: 91%; Pig: 91%; Rat: 91%; Horse: 91%; Mouse: 91%; Bovine: 91%; Guinea pig: 91%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.