ANKRD13D Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ankrd13d antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RTEHLSDQDKLRNKGGKTPFQSFLGMAQQHSSHTLAPVQQAASPTNPTAI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	ankyrin repeat domain 13 family member D
Database Link	NP_997237 Entrez Gene 338692 Human UniProt ID Q6ZTN6
Background	The function remains unknown.
Synonyms	MGC50828
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 92%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.