Frg1 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Frg1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GINSDGLVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAGDIEA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 28 kDa |
Gene Name | FSHD region gene 1 |
Database Link | |
Background | Frg1 may have a role in processing of pre-rRNA or in the assembly of rRNA into ribosomal subunits and also may be involved in pre-mRNA splicing |
Synonyms | FRG1A; FSG1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |