Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	9 kDa
Gene Name	apolipoprotein A2
Database Link	NP_001634 Entrez Gene 336 Human UniProt ID P02652
Background	This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.
Synonyms	Apo-AII; ApoA-II; apoAII
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Bovine: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Mouse: 85%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	PPAR signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.