PRAMEF10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PRAMEF10 antibody: synthetic peptide directed towards the middle region of human PRAMEF10. Synthetic peptide located within the following region: DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	PRAME family member 10
Database Link	NP_001034450 Entrez Gene 343071 Human UniProt ID O60809
Background	PRAMEF10 belongs to the PRAME family. It contains 3 LRR (leucine-rich) repeats. The function of the PRAMEF10 protein remains unknown.
Synonyms	RP5-845O24.7
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.