NALP1 (NLRP1) Rabbit Polyclonal Antibody

CAT#: TA334965

Rabbit Polyclonal Anti-NLRP1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of NLR family, pyrin domain containing 1 (NLRP1), transcript variant 1
    • 100 ug

CNY 4840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-NLRP1 antibody: synthetic peptide directed towards the N terminal of human NLRP1. Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 155 kDa
Gene Name NLR family, pyrin domain containing 1
Background This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like motif, which is possibly involved in protein-protein interactions. This protein interacts strongly with caspase 2 and weakly with caspase 9. Overexpression of this gene was demonstrated to induce apoptosis in cells. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]
Synonyms CARD7; CIDED; CLR17.1; DEFCAP; DEFCAP-L; NAC; NALP1; PP1044; S; SLEV1; VAMAS1
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Horse: 85%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%
Reference Data
Protein Families Druggable Genome
Protein Pathways NOD-like receptor signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...