C12orf40 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C12orf40 antibody: synthetic peptide directed towards the N terminal of human C12orf40. Synthetic peptide located within the following region: ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	74 kDa
Gene Name	chromosome 12 open reading frame 40
Database Link	NP_001026918 Entrez Gene 283461 Human UniProt ID Q86WS4
Background	The exact function of C12orf40 remains unknown.
Synonyms	HEL-206; HEL-S-94
Note	Immunogen Sequence Homology: Human: 100%; Pig: 83%; Horse: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.