SUNC1 (SUN3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SUN3 antibody: synthetic peptide directed towards the C terminal of human SUN3. Synthetic peptide located within the following region: IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	Sad1 and UNC84 domain containing 3
Database Link	NP_001025190 Entrez Gene 256979 Human UniProt ID Q8TAQ9
Background	SUN3 is a single-pass membrane protein. It contains 1 Unc84 (SUN) domain.
Synonyms	SUNC1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.