Sh3kbp1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Sh3kbp1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Sh3kbp1. Synthetic peptide located within the following region: QSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSRTVTISQVS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	SH3 domain-containing kinase-binding protein 1
Database Link	NP_445812 Entrez Gene 84357 Rat UniProt ID Q925Q9
Background	Sh3kbp1 binds apoptosis-linked gene 2 (ALG-2) interacting protein 1; involved in regulation of apoptosis in astrocytes.
Synonyms	CD2BP3; CIN85; GIG10; HSB-1; MIG18
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Goat: 80%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.