UFSP1 Rabbit Polyclonal Antibody
CAT#: TA334949
Rabbit Polyclonal Anti-UFSP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UFSP1 antibody is: synthetic peptide directed towards the C-terminal region of Human UFSP1. Synthetic peptide located within the following region: DPHYWGTPKSPSELQAAGWVGWQEVSAAFDPNSFYNLCLTSLSSQQQQRT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 15 kDa |
Gene Name | UFM1-specific peptidase 1 (inactive) |
Database Link | |
Background | This gene encodes a protein that is similar to other Ufm1-specific proteases. Studies in mouse determined that Ufsp1 releases Ufm1 (ubiquitin-fold modifier 1) from its bound conjugated complexes which also makes it into an active form. Because the human UFSP1 protein is shorter on the N-terminus and lacks a conserved Cys active site, it is predicted to be non-functional. |
Synonyms | UFSP |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 92%; Bovine: 86%; Rat: 79%; Pig: 77%; Guinea pig: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |