C12orf68 (CCDC184) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C12orf68 antibody: synthetic peptide directed towards the middle region of human LOC387856. Synthetic peptide located within the following region: LQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	coiled-coil domain containing 184
Database Link	NP_001013657 Entrez Gene 387856 Human UniProt ID Q52MB2
Background	The exact function of LOC387856 remains unknown.
Synonyms	C12orf68
Note	Immunogen Sequence Homology: Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.