DYNLT4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TCTEX1D4 antibody: synthetic peptide directed towards the middle region of human TCTEX1D4. Synthetic peptide located within the following region: VCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	Tctex1 domain containing 4
Database Link	NP_001013654 Entrez Gene 343521 Human UniProt ID Q5JR98
Background	TCTEX1D4 (also known as TCTEX1D4) belongs to the dynein light chain Tctex-type family. The exact function of TCTEX1D4 remains unknown.
Synonyms	TCTEX1D4
Note	Immunogen Sequence Homology: Human: 100%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.