OCC1 (C12orf75) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C12orf75 antibody is: synthetic peptide directed towards the N-terminal region of Human C12orf75. Synthetic peptide located within the following region: QGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	6 kDa
Gene Name	chromosome 12 open reading frame 75
Database Link	NP_001138671 Entrez Gene 387882 Human UniProt ID Q8TAD7
Background	The function of this protein remains unknown.
Synonyms	AGD3; OCC-1; OCC1
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 86%; Rat: 86%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.