KIAA1751 (CFAP74) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C1orf222 antibody is: synthetic peptide directed towards the C-terminal region of Human C1orf222. Synthetic peptide located within the following region: EELRPILVTLDYIQFDTDTPAPPATRELQVGCIRTTQPSPKKTVEFSIDS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	cilia and flagella associated protein 74
Database Link	NP_001003808 Entrez Gene 339457 Entrez Gene 85452 Human UniProt ID Q9C0B2
Background	The function of this protein remains unknown.
Synonyms	MGC133181
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 90%; Dog: 86%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.