VXN Rabbit Polyclonal Antibody
CAT#: TA334828
Rabbit Polyclonal Anti-C8orf46 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-C8orf46 antibody is: synthetic peptide directed towards the C-terminal region of Human C8orf46. Synthetic peptide located within the following region: KKMTEEYPALPQGAEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATN |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 22 kDa |
Gene Name | chromosome 8 open reading frame 46 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | MGC33510 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
The proteome of granulovacuolar degeneration and neurofibrillary tangles in Alzheimer’s disease
,null,
Acta Neuropathologica
,PubMed ID 33492460
[VXN]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |