MAZ Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
CNY 9998.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MAZ antibody: synthetic peptide directed towards the middle region of human MAZ. Synthetic peptide located within the following region: ALEKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMP |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 48 kDa |
Gene Name | MYC associated zinc finger protein |
Database Link | |
Background | MAZ may function as a transcription factor with dual roles in transcription initiation and termination.It binds to two sites, ME1a1 and ME1a2, within the c-myc promoter having greater affinity for the former. It also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors. |
Synonyms | Pur-1; PUR1; SAF-1; SAF-2; SAF-3; ZF87; Zif87; ZNF801 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |