PREB Rabbit Polyclonal Antibody

CAT#: TA334757

Rabbit Polyclonal Anti-PREB Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of prolactin regulatory element binding (PREB)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human prolactin regulatory element binding (PREB), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human prolactin regulatory element binding (PREB), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PREB antibody: synthetic peptide directed towards the N terminal of human PREB. Synthetic peptide located within the following region: RVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 45 kDa
Gene Name prolactin regulatory element binding
Background PREB encodes a protein that specifically binds to a Pit1-binding element of the prolactin (PRL) promoter. This protein may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p.
Synonyms SEC12
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Guinea pig: 91%; Mouse: 83%; Bovine: 83%
Reference Data
Protein Families Transcription Factors, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...