RGS20 Rabbit Polyclonal Antibody
CAT#: TA334733
Rabbit Polyclonal Anti-RGS20 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RGS20 antibody: synthetic peptide directed towards the middle region of human RGS20. Synthetic peptide located within the following region: NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | regulator of G-protein signaling 20 |
Database Link | |
Background | Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination. |
Synonyms | g(z)GAP; gz-GAP; RGSZ1; ZGAP1 |
Note | Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Rabbit: 93%; Dog: 92%; Bovine: 86%; Zebrafish: 86%; Mouse: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |