KIFC3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KIFC3 antibody: synthetic peptide directed towards the C terminal of human KIFC3. Synthetic peptide located within the following region: EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	93 kDa
Gene Name	kinesin family member C3
Database Link	NP_005541 Entrez Gene 3801 Human UniProt ID Q9BVG8
Background	KIFC3 belongs to the kinesin-like protein family. It contains 1 kinesin-motor domain. KIFC3 is the minus-end microtubule-dependent motor protein. It is involved in apically targeted transport.
Synonyms	DKFZp686D23201; FLJ34694
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Mouse: 92%; Guinea pig: 92%; Dog: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.