Parathyroid hormone related protein (PTHLH) Rabbit Polyclonal Antibody
CAT#: TA334683
Rabbit Polyclonal Anti-Pthlh Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human, Mouse |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Pthlh antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKK |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 16 kDa |
| Gene Name | parathyroid hormone-like hormone |
| Database Link | |
| Background | Pthlh is a neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. It regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is required for skeletal homeostasis. It promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. It upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath. |
| Synonyms | BDE2; HHM; PLP; PTHR; PTHRP |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 85% |
| Reference Data | |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
其它Parathyroid hormone related protein产品
