SMPDL3B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SMPDL3B antibody: synthetic peptide directed towards the N terminal of human SMPDL3B. Synthetic peptide located within the following region: ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	sphingomyelin phosphodiesterase acid like 3B
Database Link	NP_055289 Entrez Gene 27293 Human UniProt ID Q92485
Background	Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.
Synonyms	ASML3B
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Horse: 92%; Rabbit: 92%; Dog: 85%; Rat: 85%; Mouse: 85%; Bovine: 85%; Zebrafish: 85%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.