Chymotrypsin (CTRC) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CTRC antibody: synthetic peptide directed towards the N terminal of human CTRC. Synthetic peptide located within the following region: LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	chymotrypsin C
Database Link	NP_009203 Entrez Gene 11330 Human UniProt ID Q99895
Background	CTRC is a member of the peptidase S1 family. The protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Synonyms	CLCR; ELA4
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 93%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.