gamma Sarcoglycan (SGCG) Rabbit Polyclonal Antibody

CAT#: TA334659

Rabbit Polyclonal Anti-SGCG Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4537.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SGCG antibody: synthetic peptide directed towards the middle region of human SGCG. Synthetic peptide located within the following region: FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 32 kDa
Gene Name sarcoglycan gamma
Background Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C).Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms A4; DAGA4; DMDA; DMDA1; LGMD2C; MAM; SCARMD2; SCG3; TYPE
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Viral myocarditis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...