SLC9C1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Slc9a10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: IQEKAKVVTFDCGNNIFEEGDEPEGIYVIISGMVKLKRSKPHLEMDRVSS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	120 kDa
Gene Name	solute carrier family 9 member C1
Database Link	NP_898884 Entrez Gene 288117 Rat UniProt ID Q4G0N8
Background	The function of this protein remains unknown.
Synonyms	NHE; NHE-10; SLC9A10; sperm-NHE
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Bovine: 93%; Mouse: 86%; Rat: 79%; Guinea pig: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.