SLC36A2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC36A2 antibody: synthetic peptide directed towards the N terminal of human SLC36A2. Synthetic peptide located within the following region: TFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTGILGLPLAVKNAGIL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	solute carrier family 36 member 2
Database Link	NP_861441 Entrez Gene 153201 Human UniProt ID Q495M3
Background	SLC36A2 is involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids amino acids such as glycine, alanine and proline. SLC36A2 is inhibited by sarcosine.
Synonyms	PAT2; TRAMD1
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.