SLC25A41 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Slc25a25 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Slc25a25. Synthetic peptide located within the following region: MSSLFKQILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	solute carrier family 25 member 41
Database Link	NP_775908 Entrez Gene 103775 Mouse UniProt ID Q8N5S1
Background	Slc25a25 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
Synonyms	APC4
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.