SLCO6A1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLCO6A1 antibody: synthetic peptide directed towards the C terminal of human SLCO6A1. Synthetic peptide located within the following region: LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	79 kDa
Gene Name	solute carrier organic anion transporter family member 6A1
Database Link	NP_775759 Entrez Gene 133482 Human UniProt ID Q86UG4
Background	The function remains unknown.
Synonyms	CT48; GST; OATP-I; OATP6A1; OATPY
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Pig: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.