Glutaminase (GLS) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	73 kDa
Gene Name	glutaminase
Database Link	NP_055720 Entrez Gene 24398 RatEntrez Gene 2744 Human UniProt ID O94925
Background	Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances
Synonyms	AAD20; GAC; GAM; GLS1; KGA
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Dog: 86%; Mouse: 86%
Reference Data
Protein Pathways	Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, D-Glutamine and D-glutamate metabolism, Metabolic pathways, Nitrogen metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.