PPIL2 Rabbit Polyclonal Antibody
CAT#: TA334517
Rabbit Polyclonal Anti-PPIL2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 4840.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PPIL2 antibody: synthetic peptide directed towards the middle region of human PPIL2. Synthetic peptide located within the following region: MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 59 kDa |
| Gene Name | peptidylprolyl isomerase like 2 |
| Database Link | |
| Background | This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. This protein interacts with the proteinase inhibitor eglin c and is localized in the nucleus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Synonyms | CYC4; Cyp-60; CYP60; hCyP-60; UBOX7 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 86% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
