Phpt1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Phpt1 antibody is: synthetic peptide directed towards the C-terminal region of Phpt1. Synthetic peptide located within the following region: DCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYEVT
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	14 kDa
Gene Name	phosphohistidine phosphatase 1
Database Link	NP_083569 Entrez Gene 75454 Mouse UniProt ID Q9DAK9
Background	Phpt1 exhibits phosphohistidine phosphatase activity.
Synonyms	1700008C22Rik; bA216L13.10; CGI-202; DKFZp564M173; HSPC141; OTTHUMP00000022620; PHP14
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.