Ankyrin repeat domain containing protein 33 (ANKRD33) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANKRD33 antibody is: synthetic peptide directed towards the C-terminal region of Human ANKRD33. Synthetic peptide located within the following region: WVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	ankyrin repeat domain 33
Database Link	NP_872414 Entrez Gene 341405 Human UniProt ID Q7Z3H0
Background	The function of this protein remains unknown.
Synonyms	C12orf7; PANKY
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Dog: 79%; Pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.