UQCRQ Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-UQCRQ antibody is: synthetic peptide directed towards the middle region of Human UQCRQ. Synthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	10 kDa
Gene Name	ubiquinol-cytochrome c reductase complex III subunit VII
Database Link	NP_055217 Entrez Gene 27089 Human UniProt ID O14949
Background	This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain.
Synonyms	MC3DN4; QCR8; QP-C; QPC; UQCR7
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data
Protein Pathways	Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.