MTERF2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MTERFD3 antibody is: synthetic peptide directed towards the N-terminal region of Human MTERFD3. Synthetic peptide located within the following region: TAVNTQRKLWQLVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQEL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	mitochondrial transcription termination factor 2
Database Link	NP_079474 Entrez Gene 80298 Human UniProt ID Q49AM1
Background	MTERFD3 binds promoter DNA and regulates mitochondrial transcription. It is required for normal levels of transcription, both for mRNA and tRNA and is required for normal mitochondrial protein synthesis, assembly of respiratory complexes and normal mitochondrial function.
Synonyms	MTERFD3; mTERFL
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 85%; Guinea pig: 82%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.