MRPL36 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MRPL36 antibody is: synthetic peptide directed towards the C-terminal region of Human MRPL36. Synthetic peptide located within the following region: PGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	11 kDa
Gene Name	mitochondrial ribosomal protein L36
Database Link	NP_115868 Entrez Gene 64979 Human UniProt ID Q9P0J6
Background	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 2p.
Synonyms	BRIP1; L36mt; MRP-L36; PRPL36; RPMJ
Note	Immunogen Sequence Homology: Human: 100%; Horse: 86%; Zebrafish: 85%; Rat: 83%; Mouse: 83%; Dog: 82%; Pig: 79%; Bovine: 79%; Rabbit: 79%; Yeast: 77%; Guinea pig: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.