PDZD6 (INTU) Rabbit Polyclonal Antibody
CNY 5250.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-INTU antibody is: synthetic peptide directed towards the C-terminal region of Human INTU. Synthetic peptide located within the following region: TLEEVAQLSGSIHPQLIKNFHQCCLSIRAVFQQTLVEEKKKGLNSGDHSD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 104 kDa |
Gene Name | inturned planar cell polarity protein |
Database Link | |
Background | INTU plays a key role in ciliogenesis and embryonic development. INTU is a regulator of cilia formation by controlling the organization of the apical actin cytoskeleton and the positioning of the basal bodies at the apical cell surface, which in turn is essential for the normal orientation of elongating ciliary microtubules. It plays a key role in definition of cell polarity via its role in ciliogenesis but not via conversion extension and has an indirect effect on hedgehog signaling. |
Synonyms | INT; PDZD6; PDZK6 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |