SLC17A2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC17A2 antibody: synthetic peptide directed towards the middle region of human SLC17A2. Synthetic peptide located within the following region: VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	solute carrier family 17 member 2
Database Link	NP_005826 Entrez Gene 10246 Human UniProt ID O00624
Background	SLC17A2 is a member of the solute carrier family.
Synonyms	NPT3
Note	Immunogen Sequence Homology: Human: 100%; Rat: 92%; Pig: 91%; Guinea pig: 91%; Mouse: 85%; Bovine: 85%; Horse: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.